PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000232860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 1275aa    MW: 143243 Da    PI: 8.366
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000232860genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.71.3e-10104154757
                    --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     t+ q+e+Le+++ +++yps+ ++e  A+  gLt +qV+ WF  +R +ek+
  MDP0000232860 104 KTRLQVEALESFYSEEKYPSRMAMECHAAAFGLTYKQVRGWFVEKRRREKR 154
                    5889*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-1094156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-1094158IPR009057Homeodomain-like
PROSITE profilePS5007112.50395155IPR001356Homeobox domain
SMARTSM003891.1E-698159IPR001356Homeobox domain
PfamPF000466.7E-8104154IPR001356Homeobox domain
CDDcd000861.03E-6108154No hitNo description
SMARTSM005716.0E-7500559IPR018501DDT domain
PROSITE profilePS5082711.342500559IPR018501DDT domain
PfamPF027916.9E-8503554IPR018501DDT domain
PfamPF156122.4E-7782820IPR028942WHIM1 domain
PfamPF156134.2E-9913985IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1275 aa     Download sequence    Send to blast
MGFKSIYMGW ADWATTATRN KTKHADFRAH SPNSISLQLR HRRSRSHIAG GSPSLLACTT  60
PKHFSAFGFC TSAASGNGGE IFVIFCDFEK LEMKGKMMEK TKKKTRLQVE ALESFYSEEK  120
YPSRMAMECH AAAFGLTYKQ VRGWFVEKRR REKRGNRTSE LGAGDTRIVK HGRSKTKASS  180
SSRYMKTSLF NKKERMKWNH VQELLTPDNI LKKVFRKDGP PLGVEFDPLP SGALCHSPDS  240
PDFPSPCKEN NRATKRRKVT EQAVINHQDC NKSAPVKKHG VGKGFMMNNQ DCNKSAPVQK  300
HGVGKGLITN HQDCNKSAPV QKHGVGKGLI TNHQDCNKSA PVQKHGVGKG LMTVWQATNP  360
NARDFPIEMG LANGEVAGVS LIQTSVSRKP VTRNRRLQPK KCVRMEANNE NQKFPGNEKC  420
ELALEGTGSQ EHSDKIAMLV DDEELEQREL QARPNSLVCS YHFSNGDHAC SLCKDLLAKF  480
PPNSVKMKLP FDMQPWDSSP EIVKKLFKVF HFLYTYAVMV DISSFTIDEL AQAFHDKDSM  540
LLGKIHVALL KLFLTNVEAE LFCGSIPHLS KSCNFLAFIH SVENQESTLE FWKRSLNPLT  600
WTEILRQVLI AAGFGSKQGA MRRDALSKEM GLMVKYGLRP GTLKGELFRV LLEQGIHGLK  660
VSELAKSLQI SELNLSSGIE ELESLICSTL SSDITLFEKI SSSTYRVRIN SSKKEIEESQ  720
SDTEDSGAVD DELGDSGTCS SDDDSGWNSR NSRIRKLTYT NNGRSKDNVL TVHTEIDESX  780
PGEVWLLGLM EGEYSDLSIE EKLNALVALI DLLHAGSSFR IEDPTNAVAE CTLSSLHSGS  840
GAKIKRLSAK QHSDPRSTWV HAGHMGGAKE DSTLKFHPLD SSATISKFSD ERFSTKGKNG  900
KDKDVQFDVH PMQSVFLGSD RRYNRYWLXL GPCNAYDPGH RRVYFESSED GHWEVIDTEE  960
ALYALLSVLD DRGKREALLI ESVEKRIAFL CQAMSSRMVT XDKIDSLAQS DQSNPDNVRE  1020
DTYSPVSEVD NLSGTVNGSP PSSGAVVLEV TKKGEEQKRK WKRIQAFDSW LWNFFYLELN  1080
AVKLGKRSYF DTLHRCESCH DLYWKDEKHC RICHTTFELH FDLEERYAIH VATCKEKEAS  1140
DTFPKHRVLS SQIQSLKAAM HAIESVMPED ALLGAWKKSA HKLWVKRLRR TSSLAELLQV  1200
LADFVGAINE ERLYEGNIVH GSYNFTEELI ASFARIPHTT SSVALWLVKL DALISPYLER  1260
AHSEKRNEMS IRGNL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4655856e-32AM465585.2 Vitis vinifera contig VV78X239647.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228086.10.0PREDICTED: uncharacterized protein LOC103327533
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLM5X3K80.0M5X3K8_PRUPE; Uncharacterized protein
STRINGVIT_19s0085g00350.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61181519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator